DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Ikzf1

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_006251553.1 Gene:Ikzf1 / 305501 RGDID:1562979 Length:514 Species:Rattus norvegicus


Alignment Length:314 Identity:52/314 - (16%)
Similarity:107/314 - (34%) Gaps:91/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RERRQRESEEEYRKRLLRNAEANR--------QRRQNESDIERAMRLVRNAARQRLRRAMESPDQ 222
            |..:||.|.||:::|.....|:..        :...|.|::                        
  Rat   206 RSYKQRSSLEEHKERCHNYLESMGLPGMYPVIKEETNHSEM------------------------ 246

  Fly   223 RAKRLAKLAERMRMYRASETNDQRKLRLAEMAARARQRIANESPEERKERLRKLNDYAKKVREKK 287
             |:.|.|:..            :|.|.|..:|:...:|.::...:...::......|.....||.
  Rat   247 -AEDLCKIGA------------ERSLVLDRLASNVAKRKSSMPQKFLGDKCLSDMPYDSANYEKD 298

  Fly   288 KVL-KHV--------VVHGGSSSV--VVSTPTSSS------SSTDQQHHHQQQQQQQQQQQQQQQ 335
            ::: .||        :.:.|:.|:  :|.||..||      ||..|.|........:.....|..
  Rat   299 EMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDS 363

  Fly   336 QQQVLAVAAAAAAAAAANCTNEHTINLNQATTTATTTTTDEAGTPQPAEDQQHLVTAAAYQQHQA 400
            ..:.|.:.:.|.:.:            ::...:.:.:..|...|...||:|:             
  Rat   364 AVENLLLLSKAKSVS------------SEREASPSNSCQDSTDTESNAEEQR------------- 403

  Fly   401 LAGVEYMGQGMFLAPGSLRPPMQLKQEPQTPQQQQITQQQLQQQHQRYTITGQQ 454
             :|:.|:..  .:.|.: |..:.||:|.:..:..:...:..|...:..:.:|:|
  Rat   404 -SGLIYLTN--HITPHA-RNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
Ikzf1XP_006251553.1 C2H2 Zn finger 117..137 CDD:275368
zf-H2C2_2 130..154 CDD:404364
COG5048 141..>420 CDD:227381 46/279 (16%)
C2H2 Zn finger 145..165 CDD:275368
zf-H2C2_2 157..182 CDD:404364
C2H2 Zn finger 173..193 CDD:275368
C2H2 Zn finger 201..222 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.