DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Ikzf3

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001100517.1 Gene:Ikzf3 / 303511 RGDID:1307024 Length:509 Species:Rattus norvegicus


Alignment Length:205 Identity:47/205 - (22%)
Similarity:83/205 - (40%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RERRQRESEEEYRKR---LLRNAE----ANRQRRQNESDI--ERAM---RLVRNAARQRLRRAME 218
            |..:||.|.||:::|   .|:|.:    |:.:.|..::::  |||:   ||..|.|:::     .
  Rat   209 RSYKQRSSLEEHKERCRAFLQNPDLGDAASVEARHIKAEMGSERALVLDRLASNVAKRK-----S 268

  Fly   219 SPDQR---AKRLAKLAERMRMYRASETNDQRKLRLAEMA---------ARARQRIANESPEERKE 271
            |..|:   .||....|.....|...:.|:..:.|:.:.|         |.|.:.:....|....|
  Rat   269 SMPQKFIGEKRHCFDANYNPGYMYEKENEMMQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSE 333

  Fly   272 RLRKLNDY-------------AKKVREKKKVL---KHVVVHGGSSSVVVSTPTSSSSSTDQQHHH 320
            .:..::..             |.:..|||::|   |.:....|     :|...|:..|||...:|
  Rat   334 MVPVISSVYPIALTRADMPNGAPQELEKKRILLPEKILPSERG-----LSPNNSAQDSTDTDSNH 393

  Fly   321 QQQQQQQQQQ 330
            :.:|....||
  Rat   394 EDRQNHIYQQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
Ikzf3NP_001100517.1 COG5048 <107..>219 CDD:227381 4/9 (44%)
C2H2 Zn finger 120..140 CDD:275368
zf-H2C2_2 133..157 CDD:290200
C2H2 Zn finger 148..168 CDD:275368
zf-H2C2_2 160..183 CDD:290200
C2H2 Zn finger 176..196 CDD:275368
zf-H2C2_2 192..213 CDD:290200 1/3 (33%)
C2H2 Zn finger 204..220 CDD:275368 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.