DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Vat1l

DIOPT Version :10

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_011246696.1 Gene:Vat1l / 270097 MGIID:2142534 Length:422 Species:Mus musculus


Alignment Length:31 Identity:9/31 - (29%)
Similarity:18/31 - (58%) Gaps:3/31 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   903 VVKADNDDSPLGGGDGSN---DHEQLPALQL 930
            :::.:....|..|||||:   |.:::.|:.|
Mouse    15 MIEKETSKEPAEGGDGSHRLGDAQEMRAVVL 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK12705 153..>282 CDD:237178
Vat1lXP_011246696.1 MDR3 41..358 CDD:176236 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.