DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Zfp382

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001380612.1 Gene:Zfp382 / 246264 RGDID:708385 Length:567 Species:Rattus norvegicus


Alignment Length:176 Identity:38/176 - (21%)
Similarity:67/176 - (38%) Gaps:36/176 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   818 KRAQIRATENTDER-KERLSKQAEYAR----MRRMRSHTPRSSSATSTEFRAKTEEEDECQDDDT 877
            |...||..|..:|. .||:.....|..    :.:.|.:..:..::.......|..:|.....:.|
  Rat    57 KPDMIRKLEQGEELWTERMFPSQSYLEDEEVLVKFRDYQDKPPTSIVIINHKKLIKERNNVYEKT 121

  Fly   878 SAEHHM-------YESEAVSVTGTGSDGGFVSVVKADNDDSPLGG--GDGSNDHEQLPALQLQQH 933
            ...:|:       |:|:. .|....||  |:|     .|.:|:.|  ||.|...|.:        
  Rat   122 LGNNHIISKTLFEYKSDG-KVLKNISD--FIS-----RDINPVMGTLGDSSEWEESV-------- 170

  Fly   934 ELQQIAGSLQQQHLVPHPHHEAIVLNQQHRLVTISQHQQQQLHQQQ 979
                :....::.|.|| ..::.|..|....| .::|||:.|:.:|:
  Rat   171 ----LTSEQEKTHPVP-TLYKQIGRNLSSSL-ELAQHQKTQIPEQR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
Zfp382NP_001380612.1 Mediates interaction with TRIM28. /evidence=ECO:0000269|PubMed:11154279 1..105 9/47 (19%)
Represses transcription 10..51
KRAB 12..72 CDD:214630 5/14 (36%)
Represses transcription 75..210 30/156 (19%)
C2H2 Zn finger 273..289 CDD:275368
COG5048 <293..532 CDD:227381
C2H2 Zn finger 297..317 CDD:275368
C2H2 Zn finger 325..345 CDD:275368
C2H2 Zn finger 353..373 CDD:275368
C2H2 Zn finger 381..401 CDD:275368
C2H2 Zn finger 409..429 CDD:275368
C2H2 Zn finger 437..457 CDD:275368
C2H2 Zn finger 465..485 CDD:275368
C2H2 Zn finger 493..513 CDD:275368
C2H2 Zn finger 521..541 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.