DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Zfp382

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001074476.1 Gene:Zfp382 / 233060 MGIID:3588204 Length:579 Species:Mus musculus


Alignment Length:345 Identity:68/345 - (19%)
Similarity:112/345 - (32%) Gaps:116/345 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 PVGRGRPRKNPLPSEEQLKVNSLLEQELNQMLSAPQLATSTPRRGRPLSQASQQHHQELSQIHVH 753
            |.||.||...|.|.|| |:........||.|...|                     .....:.|.
Mouse     8 PRGRARPGLFPFPKEE-LRQGGSSPANLNAMSKGP---------------------VSFKDVTVD 50

  Fly   754 STADGDSRTPVLTPRRSGANKYETEEEKRIRLDKMA---AHQRAVRANETPEQRATRLQKLSERA 815
            .|.:...|   |.|           .:|.:..|.|.   .|..:|..:.|   :...::||.:..
Mouse    51 FTQEEWQR---LDP-----------AQKALYRDVMLENYCHFISVGFHIT---KPDMIRKLEQGE 98

  Fly   816 RLKRAQIRATENTDERKERLSKQAEYARMRRMRSHTPRSSSATSTEFRAKTEEEDECQDDDTSAE 880
            .|...:|..:::..|.:|.|.|.::|                           :|:........:
Mouse    99 ELWTERIFPSQSYLEEEEVLVKFSDY---------------------------QDKPPKSIVIIK 136

  Fly   881 HHMYESEAVSVTGTG---------------SDGGFVSVVK--ADNDDSP-LGGGDGSNDHEQLPA 927
            |.....|..||.|..               |||..:..:.  ...|.:| :|...||.:.|    
Mouse   137 HKKLIKERSSVYGEALGKNRVVSKTLFEYKSDGKVLKNISEFISRDINPAMGKLGGSKEWE---- 197

  Fly   928 LQLQQHELQQIAGSLQQQHLVPHPHHEAIVLNQQ-HRLVT----ISQHQQQQLHQQQHPGFSK-- 985
                    ..|..|.|::      .|.|.:|::| .|.::    ::|||:.|:.:|:.. ::|  
Mouse   198 --------GSILTSKQEK------THPASILHKQIGRALSSEWDLAQHQKTQIPEQRFE-YNKCD 247

  Fly   986 ---LQTVKDYANAAGGGGGG 1002
               |.|..::.:.....|||
Mouse   248 SSFLMTGVEFPHGRAHRGGG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272 8/16 (50%)
Zfp382NP_001074476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 12/29 (41%)
Mediates interaction with TRIM28. /evidence=ECO:0000250 12..135 32/188 (17%)
Represses transcription. /evidence=ECO:0000250 40..81 10/75 (13%)
KRAB 42..102 CDD:214630 14/76 (18%)
KRAB 42..81 CDD:279668 9/52 (17%)
Represses transcription. /evidence=ECO:0000250 105..240 33/179 (18%)
C2H2 Zn finger 303..319 CDD:275368
Required for transcriptional repression activity, probably mediates sequence-specific DNA-binding. /evidence=ECO:0000250 325..579
zf-C2H2 325..347 CDD:278523
C2H2 Zn finger 327..347 CDD:275368
zf-H2C2_2 339..364 CDD:290200
C2H2 Zn finger 355..375 CDD:275368
C2H2 Zn finger 383..403 CDD:275368
COG5048 <411..562 CDD:227381
C2H2 Zn finger 411..431 CDD:275368
zf-H2C2_2 423..448 CDD:290200
C2H2 Zn finger 439..459 CDD:275368
zf-H2C2_2 452..474 CDD:290200
C2H2 Zn finger 467..487 CDD:275368
zf-H2C2_2 480..504 CDD:290200
C2H2 Zn finger 495..515 CDD:275368
C2H2 Zn finger 523..543 CDD:275368
zf-C2H2 523..543 CDD:278523
zf-H2C2_2 535..560 CDD:290200
C2H2 Zn finger 551..571 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.