DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Ikzf3

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_035901.1 Gene:Ikzf3 / 22780 MGIID:1342542 Length:507 Species:Mus musculus


Alignment Length:204 Identity:47/204 - (23%)
Similarity:83/204 - (40%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RERRQRESEEEYRKR---LLRNAE----ANRQRRQNESDI--ERAM---RLVRNAARQRLRRAME 218
            |..:||.|.||:::|   .|:|.:    |:.:.|..::::  |||:   ||..|.|:::     .
Mouse   208 RSYKQRSSLEEHKERCRAFLQNPDLGDAASVEARHIKAEMGSERALVLDRLASNVAKRK-----S 267

  Fly   219 SPDQR---AKRLAKLAERMRMYRASETNDQRKLRLAEMA---------ARARQRIANESPEERKE 271
            |..|:   .||....|.....|...:.|:..:.|:.:.|         |.|.:.:....|....|
Mouse   268 SMPQKFIGEKRHCFDANYNPGYMYEKENEMMQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSE 332

  Fly   272 RLRKLNDY-------------AKKVREKKKVL---KHVVVHGGSSSVVVSTPTSSSSSTDQQHHH 320
            .:..::..             |.:..|||::|   |.:....|     :|...|:..|||...:|
Mouse   333 MVPVISSVYPIALTRADMPNGAPQEMEKKRILLPEKILPSERG-----LSPNNSAQDSTDTDSNH 392

  Fly   321 QQQQQQQQQ 329
            :.:|...||
Mouse   393 EDRQHLYQQ 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
Ikzf3NP_035901.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85
COG5048 <105..>218 CDD:227381 4/9 (44%)
C2H2 Zn finger 119..139 CDD:275368
zf-H2C2_2 132..156 CDD:290200
C2H2 Zn finger 147..167 CDD:275368
zf-H2C2_2 159..182 CDD:290200
C2H2 Zn finger 175..195 CDD:275368
zf-H2C2_2 191..212 CDD:290200 1/3 (33%)
C2H2 Zn finger 203..219 CDD:275368 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..396 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.