DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and IKZF1

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_011513360.1 Gene:IKZF1 / 10320 HGNCID:13176 Length:563 Species:Homo sapiens


Alignment Length:285 Identity:51/285 - (17%)
Similarity:97/285 - (34%) Gaps:84/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   733 GRPLSQ-ASQQHHQELSQIHVHSTADGDSRTPVLTPRRSGANKYETEE-------EKRIRLDKMA 789
            ||...| :|.:.|:|....::.|.....:..||:   :...|..|..|       |:.:.||::|
Human   251 GRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVI---KEETNHSEMAEDLCKIGSERSLVLDRLA 312

  Fly   790 AHQRAVRA------------NETPEQRATRLQKLSER------------------ARLKRAQIRA 824
            ::....::            ::||...:...:|.:|.                  |...|..::.
Human   313 SNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQT 377

  Fly   825 TENTDERKERLSKQAEYARMRRMRSHTPRSSSATSTEFRAKTEEEDECQDDDTSAEHHMYESEAV 889
            .....|....:|..  |...:.:...||||:.:.                .|::.|:.:..|:| 
Human   378 PPGGSEVVPVISPM--YQLHKPLAEGTPRSNHSA----------------QDSAVENLLLLSKA- 423

  Fly   890 SVTGTGSDGGFVSVVKADNDDSPLGGGDGSNDHEQLPALQLQQHELQQIAGSLQQQHLVPHPHHE 954
                        .:|.::.:.||......|.|.|       ..:|.|:........|:.||..: 
Human   424 ------------KLVPSEREASPSNSCQDSTDTE-------SNNEEQRSGLIYLTNHIAPHARN- 468

  Fly   955 AIVLNQQHR----LVTISQHQQQQL 975
            .:.|.::||    |...|::.|..|
Human   469 GLSLKEEHRAYDLLRAASENSQDAL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
IKZF1XP_011513360.1 C2H2 Zn finger 163..183 CDD:275368
zf-H2C2_2 176..200 CDD:372612
COG5048 187..>343 CDD:227381 18/94 (19%)
C2H2 Zn finger 191..211 CDD:275368
zf-H2C2_2 203..228 CDD:372612
C2H2 Zn finger 219..239 CDD:275368
C2H2 Zn finger 247..268 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.