DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Ikzf4

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_006240794.1 Gene:Ikzf4 / 100361923 RGDID:2319157 Length:586 Species:Rattus norvegicus


Alignment Length:535 Identity:90/535 - (16%)
Similarity:148/535 - (27%) Gaps:221/535 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 ERLRKLNDYAKKVREKKKVLKHVVVHGGSSSVV-----------------VSTPTSSSSSTDQQH 318
            ||....|.......:|..:|:|:.:|.|.....                 :.|.:.||.:..:.:
  Rat   184 ERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPY 248

  Fly   319 HHQQQQQQQQQQQQQQQQQQVLAVAAAAAAAAAANCTNEHTINLNQATTTATTTTTDEAGTPQPA 383
            ......:..:||...::.::              .|.|    .|...:|.|.|.    ||  ||.
  Rat   249 KCNYCGRSYKQQSTLEEHKE--------------RCHN----YLQSLSTDAQTL----AG--QPG 289

  Fly   384 EDQQHLVTAAAYQQHQALAGVEYMGQGMFLAPGSLRPPM-------QLKQEPQTPQQQQITQQQL 441
            ::               :..:|.:...| |.|.:.||..       ..|::..||      |:.:
  Rat   290 DE---------------IRDLEMVPDSM-LHPSTERPTFIDRLANSLTKRKRSTP------QKFV 332

  Fly   442 QQQHQRYTI---------TGQQQQQVTAALLEGTEPGSIFVQQIYGDEGGK----GTAKLLQAHV 493
            .::..|:::         :|..::.|......|.|||.          ||.    ||..|....:
  Rat   333 GEKQMRFSLSDLPYDVNPSGGYEKDVELVAHHGLEPGF----------GGSLAFVGTEHLRPLRL 387

  Fly   494 PHFS--------IAGGQLELYPHKYAAKKQELQSDNDATVSAGGNDNSGSVSLGHNETKVIVTTA 550
            |..:        |:....::.|   ...:.||....:|        ..|...||           
  Rat   388 PPTNCISELTPVISSVYTQMQP---LPSRLELPGSREA--------GEGPEDLG----------- 430

  Fly   551 SGEQKLLKA-----TPGQAQQLYNQFPYLATFPNTTSSGNSTTSTTNVGHVGVVTAGTTTGAGGT 610
            .|...|.:|     .||.:             |:.....::.|.:.:...:|.|.:         
  Rat   431 DGGPLLYRARGSLTDPGAS-------------PSNGCQDSTDTESNHEDRIGGVVS--------- 473

  Fly   611 TTTAYYPMYHNGFQIGIGPNAVPPPFTPVNFANASGGNSPGQYNILAANPTLTVTGLGQQEQQQT 675
                          :..||...|||...|      |.:||..                       
  Rat   474 --------------LPQGPPPQPPPTIVV------GRHSPAY----------------------- 495

  Fly   676 GASSAAAPQIVTTPVGRGRPRKNPLPSEEQLKVNSLLEQELNQMLSAPQLATSTPRRGRPLSQAS 740
             |.....||       .|..|..|.||:|.|:|                    ....|.|:....
  Rat   496 -AKEDPKPQ-------EGLLRGTPGPSKEVLRV--------------------VGESGEPVKAFK 532

  Fly   741 QQHHQELSQIHVHST 755
            .:|.:.|...||..|
  Rat   533 CEHCRILFLDHVMFT 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272 7/16 (44%)
Ikzf4XP_006240794.1 C2H2 Zn finger 161..181 CDD:275368
zf-H2C2_2 174..198 CDD:404364 3/13 (23%)
C2H2 Zn finger 189..209 CDD:275368 4/19 (21%)
zf-H2C2_2 201..226 CDD:404364 4/24 (17%)
SFP1 <211..271 CDD:227516 6/73 (8%)
C2H2 Zn finger 217..237 CDD:275368 0/19 (0%)
C2H2 Zn finger 250..271 CDD:275368 2/34 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.