| Sequence 1: | NP_572341.1 | Gene: | CG3184 / 31608 | FlyBaseID: | FBgn0029892 | Length: | 356 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_492124.1 | Gene: | wdr-23 / 172518 | WormBaseID: | WBGene00008419 | Length: | 571 | Species: | Caenorhabditis elegans |
| Alignment Length: | 496 | Identity: | 89/496 - (17%) |
|---|---|---|---|
| Similarity: | 148/496 - (29%) | Gaps: | 224/496 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 HS--EDTEYSADSVEWLTHDDAATGFFACGTYQLVQEEDEPAAETSAKRPRKGRVYLYQFEEENC 68
Fly 69 RLERLQCIETSAILDMKWLPAWSSECNPHLATVNSLGQMELYEFLQDAKLLQRRTCFS------- 126
Fly 127 -----LAEQDSSEE--APLALALDWQHDGQHIRLAISDSK------------------------- 159
Fly 160 --GGLNLL--SYSSQGEIIRERSW---------------------------------------LS 181
Fly 182 HGFEAWTCAFDRWSPHI--------------------------------LYSGGDDMLLMAHDLR 214
Fly 215 TKQRAWTN---------RAHMAGVTCLLSHPRHENHLLTGSYDEQLRLFDTRSMKRSLAELDLSG 270
Fly 271 ----------GIWRLKPHPAQPDL-----------------ILAACMYTNFS------------- 295
Fly 296 ----VVQLDVAAPGLS--LLGAYEEHKSICYGADWAPWRNK 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3184 | NP_572341.1 | WD40 | 92..>267 | CDD:225201 | 52/297 (18%) |
| WD40 repeat | 141..181 | CDD:293791 | 11/107 (10%) | ||
| WD40 | <169..349 | CDD:295369 | 52/288 (18%) | ||
| WD40 repeat | 187..222 | CDD:293791 | 13/66 (20%) | ||
| WD40 repeat | 229..267 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 272..313 | CDD:293791 | 15/76 (20%) | ||
| WD40 repeat | 319..349 | CDD:293791 | 4/12 (33%) | ||
| wdr-23 | NP_492124.1 | WD40 | 119..511 | CDD:225201 | 71/401 (18%) |
| WD40 repeat | 167..205 | CDD:293791 | 5/37 (14%) | ||
| WD40 | 168..514 | CDD:295369 | 60/346 (17%) | ||
| WD40 repeat | 220..269 | CDD:293791 | 5/48 (10%) | ||
| WD40 repeat | 271..307 | CDD:293791 | 5/35 (14%) | ||
| WD40 repeat | 315..356 | CDD:293791 | 10/44 (23%) | ||
| WD40 repeat | 362..434 | CDD:293791 | 17/78 (22%) | ||
| WD40 repeat | 442..481 | CDD:293791 | 7/38 (18%) | ||
| WD40 repeat | 487..511 | CDD:293791 | 4/12 (33%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||