DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pink1 and CPK25

DIOPT Version :9

Sequence 1:NP_001027049.1 Gene:Pink1 / 31607 FlyBaseID:FBgn0029891 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001318361.1 Gene:CPK25 / 818162 AraportID:AT2G35890 Length:520 Species:Arabidopsis thaliana


Alignment Length:336 Identity:80/336 - (23%)
Similarity:133/336 - (39%) Gaps:89/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 RGMNEAADEWERLLQNQTVHLPRHPNIVCMFG-------FFCDE----------------VRNFP 406
            |.:..|..:.|.:|:.:|.||..:.|:....|       |.|.|                :.|..
plant   108 RRLMSAGLQAESVLKTKTGHLKEYYNLGSKLGHGQFGTTFVCVEKGTGEEYACKSIPKRKLENEE 172

  Fly   407 D-----------GHLLYPVAQPQRINPQG-YGRNMSLYLLMK--RYDHSLRGLLDSQDLSTRNRI 457
            |           .|||   .||..|:.:| |..:::::::|:  |.......:::....|.|...
plant   173 DVEDVRREIEIMKHLL---GQPNVISIKGAYEDSVAVHMVMELCRGGELFDRIVERGHYSERKAA 234

  Fly   458 LLLAQMLEAVNHLSRHGVAHRDLKSDNVLIELQDDAAPVLVLSDFGCCLADKVHGLRLPYVSHDV 522
            .|...:|..|......||.|||||.:|.|....|:.:|:..: |||.       .:.|....:..
plant   235 HLAKVILGVVQTCHSLGVMHRDLKPENFLFVNDDEDSPLKAI-DFGL-------SMFLKPGENFT 291

  Fly   523 DKGGNAALMAPEIFNTMPGPFAVLNYG-KADLWACGALAYEIFGNRNPFYSSSGGMARE------ 580
            |..|:...:|||:.|.        ||| :||:|:.|.:.|.:.....||:    |...|      
plant   292 DVVGSPYYIAPEVLNK--------NYGPEADIWSAGVMIYVLLSGSAPFW----GETEEEIFNEV 344

  Fly   581 -RGEMTLSLRNSDYRQDQLPPMSDACPPLLQQLVYNILNPNPSKRVSPDIAANVVQLFLWAPSNW 644
             .||:       |...|..|.:|::...|::::    |..||.:|::       .|..|..|  |
plant   345 LEGEL-------DLTSDPWPQVSESAKDLIRKM----LERNPIQRLT-------AQQVLCHP--W 389

  Fly   645 LK-AGGMPNSP 654
            :: .|..|::|
plant   390 IRDEGNAPDTP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pink1NP_001027049.1 STKc_PINK1 328..639 CDD:270920 74/318 (23%)
CPK25NP_001318361.1 STKc_CAMK 132..389 CDD:270687 69/299 (23%)
FRQ1 429..>509 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.