DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pink1 and Pink1

DIOPT Version :9

Sequence 1:NP_001027049.1 Gene:Pink1 / 31607 FlyBaseID:FBgn0029891 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001100164.1 Gene:Pink1 / 298575 RGDID:1305769 Length:257 Species:Rattus norvegicus


Alignment Length:132 Identity:35/132 - (26%)
Similarity:50/132 - (37%) Gaps:36/132 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GDSAPFFALIGVSLASGSGVLSKEDELEGVCWEIREAASRLQN-----AWNHDEISDTLDSK--- 188
            |.:.|....:.::...|.|::.::..      |.|.|||..|.     ...:.::||.||::   
  Rat    91 GGAGPCGRAVFLAFGLGLGLIEEKQA------ESRRAASACQEIQAIFTQKNKQVSDPLDTRRWQ 149

  Fly   189 -FTIDDLEIGPPIAKGCAAVVYAADFK------------------KDVASDGASLHTDAQPQATP 234
             |.::|..||..|.|||.|.||.|...                  .||.|.||.   ..|....|
  Rat   150 GFRLEDYLIGQAIGKGCNAAVYEATMPTLPQHLEKAKHLGLLGKGPDVVSKGAD---GEQAPGAP 211

  Fly   235 AF 236
            ||
  Rat   212 AF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pink1NP_001027049.1 STKc_PINK1 328..639 CDD:270920
Pink1NP_001100164.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..60
Required for outer membrane localization. /evidence=ECO:0000250|UniProtKB:Q9BXM7 111..117 0/5 (0%)
PKc_like 162..>240 CDD:304357 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340711
Domainoid 1 1.000 209 1.000 Domainoid score I2754
eggNOG 1 0.900 - - E1_KOG4158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I2856
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D161355at33208
OrthoFinder 1 1.000 - - FOG0008271
OrthoInspector 1 1.000 - - oto96678
orthoMCL 1 0.900 - - OOG6_109238
Panther 1 1.100 - - LDO PTHR22972
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7349
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.