DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fum2 and AT4G18440

DIOPT Version :9

Sequence 1:NP_727109.2 Gene:Fum2 / 31606 FlyBaseID:FBgn0029890 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_193579.2 Gene:AT4G18440 / 827575 AraportID:AT4G18440 Length:536 Species:Arabidopsis thaliana


Alignment Length:347 Identity:75/347 - (21%)
Similarity:128/347 - (36%) Gaps:83/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 HISVGMELNERL----VPAVTHLRDALKSKSDEFKDIIKIGRTHLMDAVPLTLGQEFSGYTQQLT 250
            ::|..:.|.|.|    :|.:..|..::...:..|..:..:.|||...|.|.|||:|.:.:..:|:
plant   201 NLSHALMLQEALSSVILPTMDELIKSISLIAKNFAYVPMLSRTHGQPATPTTLGKEMANFAVRLS 265

  Fly   251 NGLER-------IKGCLPRVYELALGGTAVGTGLNTRKGFAEKVAKRISE-------LTCLPFVS 301
            .  ||       |||        ...| |||........::......:||       ||..|:|:
plant   266 E--ERRYLSETKIKG--------KFAG-AVGNYNAHISAYSNIDWPHVSEEFVTSLGLTFNPYVT 319

  Fly   302 APNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRLLGSGPRCGLGELMLPENEPGSSIMPGKV 366
                  .:...|.|..:...::.....|:....||   .|....|..:......|.|||.||.||
plant   320 ------QIEPHDYMARLFNNISQFNTILIDFDRDI---WSYISLGYFKQTTKAGEIGSSTMPHKV 375

  Fly   367 NPTQCESMTMLCAQVMGNQVAVTIGGSNGHFEL--------NVFKPLVVSNVLRSIRLLADGSMT 423
            ||...|:..       ||     :|.:|.....        .:.:.|..|.|||::......|:.
plant   376 NPIDFENSE-------GN-----LGKANAELTFLSMKLPISRMQRDLTDSTVLRNMGGALGHSLL 428

  Fly   424 FSKNCVEG---LQANKERIDKIMNESLML----VTALNPHIG----YDKAALIAKTAHKNKTTLK 477
            ..|:.::|   ||.|:.|:.:.::::..:    :..:....|    |:|              ||
plant   429 AYKSAIQGIGKLQVNEARLKEDLDDNWEVLAEPIQTVMRRYGVPEPYEK--------------LK 479

  Fly   478 EEALKTGITEEQFKEWVNPKEM 499
            |......:.||..:.::...|:
plant   480 ELTRGKAVNEETIRTFIKGLEL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fum2NP_727109.2 fumC 42..503 CDD:234779 75/347 (22%)
Fumarase_classII 43..499 CDD:176465 74/345 (21%)
AT4G18440NP_193579.2 PLN02848 71..519 CDD:178440 75/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.