DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fum2 and Argl

DIOPT Version :9

Sequence 1:NP_727109.2 Gene:Fum2 / 31606 FlyBaseID:FBgn0029890 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001027234.1 Gene:Argl / 3771738 FlyBaseID:FBgn0032076 Length:469 Species:Drosophila melanogaster


Alignment Length:410 Identity:82/410 - (20%)
Similarity:149/410 - (36%) Gaps:84/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DDVISGKLYKQG-HFPLVIWQTGSGTQTNMNTNEVISN----------AAIKMMGGELGSKKPVH 170
            ||:.:.|.|.:. |        .:|...:...::::.|          ..:|::.|:    :.||
  Fly    40 DDLDASKAYAEALH--------RAGLINSAEADKLVKNLELLRFDWIEGTVKILPGD----EDVH 92

  Fly   171 PNDHVNKSQSSNDTFPTAIHISVGMELNERLVPAV-THLRDALKSKSDEFKDIIKI--------- 225
            .   ||:......|......:..|...|:::|..: ..||.|::........||:.         
  Fly    93 T---VNERLLVEITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGRLSGIIETATRQAELHL 154

  Fly   226 -----GRTHLMDAVPLTLGQEFSGYTQQLTNGLERIKGCLPRVYELALG-GTAVGTGLN-TRKGF 283
                 |.|||..|..:........:...|....:|:.....|...|.|| |...|..|. .|...
  Fly   155 GVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQRLLELRDRANVLPLGSGALAGNPLGIDRLWL 219

  Fly   284 AEKVAKRISELTCLPFVSAPNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRLLGSGPRCGLG 348
            ||::.  .|.:|.       |...|:..||.:|:.....:.:::.|.::|.|:.:..:..   ..
  Fly   220 AERLG--FSGVTA-------NSMHAVGDRDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKE---FD 272

  Fly   349 ELMLPEN-EPGSSIMPGKVNPTQCESMTMLCAQVMGN--QVAVTIGGSNGHF--ELNVFKPLVVS 408
            .:.|.:. ..|||:||.|.||...|.:..:...:..|  .:.:||.|:...:  :|...|.....
  Fly   273 FIKLADGFSSGSSLMPQKRNPDSLELIRGMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQ 337

  Fly   409 NV--LRSIRLLADGSMTFSKNCVEGLQANKERIDKIMNESLMLVTALNPHIGYDKAALIAK---- 467
            :.  |..:..:.||       .::.:|..:|.::..::.. ||.|        |.|..:.|    
  Fly   338 SFDKLSQVLEVTDG-------VLQTIQVKQESMEAALSTD-MLAT--------DWAYYLVKKGVP 386

  Fly   468 --TAHKNKTTLKEEALKTGI 485
              .||.....:..||.|.|:
  Fly   387 FRQAHHIIGRVVSEAEKRGV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fum2NP_727109.2 fumC 42..503 CDD:234779 82/410 (20%)
Fumarase_classII 43..499 CDD:176465 82/410 (20%)
ArglNP_001027234.1 PRK00855 9..460 CDD:179143 82/410 (20%)
Argininosuccinate_lyase 30..461 CDD:176463 82/410 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.