DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fum1 and LOC100535417

DIOPT Version :9

Sequence 1:NP_572339.1 Gene:Fum1 / 31605 FlyBaseID:FBgn0286222 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_003199715.2 Gene:LOC100535417 / 100535417 -ID:- Length:332 Species:Danio rerio


Alignment Length:326 Identity:246/326 - (75%)
Similarity:280/326 - (85%) Gaps:0/326 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 QSSNDTFPTAIHISVALELNNNLKPAIKTLHDALRAKSEEFKDIIKIGRTHTMDAVPLTLGQEFS 234
            ||||||||||:||:.|.|::..|.|.::||||||.||:|:||||||||||||.|||||:|||||.
Zfish     7 QSSNDTFPTAMHIAAAKEVHEVLLPGLQTLHDALAAKAEQFKDIIKIGRTHTQDAVPLSLGQEFG 71

  Fly   235 GYAQQLAYAQERIDACLPRVYELALGGTAVGTGLNTRKGFAEKCAAKIAELTSLPFVTAPNKFEA 299
            ||.||:.|:..|:.|.||||||||.||||||||||||.|||||.|.|::.||.||||||.|||||
Zfish    72 GYVQQVKYSIARVKASLPRVYELAAGGTAVGTGLNTRIGFAEKVADKVSALTGLPFVTAANKFEA 136

  Fly   300 LAARDAMVEVHGVLNTIAVSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCES 364
            |||.||:||:.|.|||:|||:|||||||||||||||.|||||.|||||||||||||||||||||:
Zfish   137 LAAHDALVELSGALNTVAVSMMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEA 201

  Fly   365 LTMLSAQVMGNQVAVTIGGSNGHFELNVFKPLIVSNVLRSIRLLSDGSRTFTANCVNGIQANREN 429
            :||::||||||.|.||:||||||||||||||:|:.|||.|.|||.|.|.:||.|||.||:||.|.
Zfish   202 MTMVAAQVMGNHVGVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDASVSFTNNCVVGIEANTER 266

  Fly   430 IAKIMNESLMLVTALNPHIGYDKAAKIAKTAHKNGTTLKEEAINLGYLTEQQFNDWVRPEQMLGP 494
            |.|:|:|||||||||||||||||||||||||||:|:||||.|:.||:|.||||.:||||..||||
Zfish   267 INKLMSESLMLVTALNPHIGYDKAAKIAKTAHKDGSTLKEAALKLGFLNEQQFEEWVRPHDMLGP 331

  Fly   495 K 495
            |
Zfish   332 K 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fum1NP_572339.1 fumC 31..495 CDD:234779 244/324 (75%)
LOC100535417XP_003199715.2 fumC <7..332 CDD:234779 244/324 (75%)
Lyase_I_like <7..328 CDD:294018 241/320 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.