DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ASHI and ndufb8

DIOPT Version :9

Sequence 1:NP_001027048.1 Gene:ND-ASHI / 31604 FlyBaseID:FBgn0029888 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_002936399.2 Gene:ndufb8 / 733466 XenbaseID:XB-GENE-962918 Length:199 Species:Xenopus tropicalis


Alignment Length:174 Identity:67/174 - (38%)
Similarity:99/174 - (56%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVARQAIRSMAGWNKDYKPGPYPQTEKERLAAAKKYYLLPEEYKPYADDGLGYGDYPKLGYGLGV 84
            :|.|.|:|:.:|..|:..|||||:|.:|:.||||||.:..|:|:||.|||:|:||||:|. ....
 Frog    32 LVQRSAVRAASGAAKNDLPGPYPKTPEEKAAAAKKYNMRVEDYEPYPDDGMGFGDYPRLP-EKSQ 95

  Fly    85 EAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPPRYSNA---YYFACFLGVMSGCLALY 146
            :.:|.:|.||:|:.:||..||:..|.|:|..:|...:..|...|.   |.|. |:|.|    ...
 Frog    96 QERDPWYSWDHPDLRRNWGEPMQWDFDMYIRNRVDTSPTPLPWNTMCKYLFG-FIGFM----LFM 155

  Fly   147 YWLDDK-KMYRPVAAKQYP---------------SPGVKHYTFE 174
            :|:.:| ::|.|||.||||               .|.||:|.|:
 Frog   156 FWVGEKYQVYPPVAPKQYPYNNLYLERGGDPAKDPPEVKNYEFK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ASHINP_001027048.1 NDUF_B8 25..164 CDD:283478 58/142 (41%)
ndufb8XP_002936399.2 NDUF_B8 37..198 CDD:368626 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3668
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47153
OrthoDB 1 1.010 - - D1427659at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.