DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ASHI and Ndufb8

DIOPT Version :9

Sequence 1:NP_001027048.1 Gene:ND-ASHI / 31604 FlyBaseID:FBgn0029888 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_080337.1 Gene:Ndufb8 / 67264 MGIID:1914514 Length:186 Species:Mus musculus


Alignment Length:152 Identity:58/152 - (38%)
Similarity:79/152 - (51%) Gaps:18/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PVVARQAIRSMAGWNKDYKPGPYPQTEKERLAAAKKYYLLPEEYKPYADDGLGYGDYPKLGYGLG 83
            |:.||:|..    ..||..||.||:|.:||.||||||.:..|:|:||.|||:||||||.|. ...
Mouse    23 PLEARRAFH----MTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLP-NRS 82

  Fly    84 VEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPP-----RYSNAYYFACFLGVMSGCL 143
            ...:|.:|.||:.|.:.|..|||..|.|:|..:|...:..|     ...:.:.|..|:..|    
Mouse    83 QHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFM---- 143

  Fly   144 ALYYWLDDK-KMYRPVAAKQYP 164
               :|:... ..|:||..||||
Mouse   144 ---FWVGHVFPSYQPVGPKQYP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ASHINP_001027048.1 NDUF_B8 25..164 CDD:283478 53/144 (37%)
Ndufb8NP_080337.1 NDUF_B8 21..186 CDD:399079 58/152 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838016
Domainoid 1 1.000 96 1.000 Domainoid score I7344
eggNOG 1 0.900 - - E1_KOG4040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3668
Inparanoid 1 1.050 97 1.000 Inparanoid score I5018
Isobase 1 0.950 - 0 Normalized mean entropy S5909
OMA 1 1.010 - - QHG47153
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008020
OrthoInspector 1 1.000 - - oto94315
orthoMCL 1 0.900 - - OOG6_105301
Panther 1 1.100 - - LDO PTHR12840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4440
SonicParanoid 1 1.000 - - X6915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.