DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ASHI and NDUFB8

DIOPT Version :9

Sequence 1:NP_001027048.1 Gene:ND-ASHI / 31604 FlyBaseID:FBgn0029888 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_004995.1 Gene:NDUFB8 / 4714 HGNCID:7703 Length:186 Species:Homo sapiens


Alignment Length:152 Identity:60/152 - (39%)
Similarity:82/152 - (53%) Gaps:18/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PVVARQAIRSMAGWNKDYKPGPYPQTEKERLAAAKKYYLLPEEYKPYADDGLGYGDYPKLGYGLG 83
            |:.||.|    :...||..|||||:|.:||.||||||.:..|:|:||.|||:||||||||. ...
Human    23 PLGARTA----SHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLP-DRS 82

  Fly    84 VEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPPRYSNAYYFAC-----FLGVMSGCL 143
            ...:|.:|.||.|..:.|..||:....|:|:.:|...:..|   .:::..|     ||..|    
Human    83 QHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTP---VSWHVMCMQLFGFLAFM---- 140

  Fly   144 ALYYWLDD-KKMYRPVAAKQYP 164
            ....|:.| ..:|:||..||||
Human   141 IFMCWVGDVYPVYQPVGPKQYP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ASHINP_001027048.1 NDUF_B8 25..164 CDD:283478 55/144 (38%)
NDUFB8NP_004995.1 NDUF_B8 21..186 CDD:310423 60/152 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147927
Domainoid 1 1.000 100 1.000 Domainoid score I7036
eggNOG 1 0.900 - - E1_KOG4040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3668
Inparanoid 1 1.050 100 1.000 Inparanoid score I5003
Isobase 1 0.950 - 0 Normalized mean entropy S5909
OMA 1 1.010 - - QHG47153
OrthoDB 1 1.010 - - D1427659at2759
OrthoFinder 1 1.000 - - FOG0008020
OrthoInspector 1 1.000 - - oto90729
orthoMCL 1 0.900 - - OOG6_105301
Panther 1 1.100 - - LDO PTHR12840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.720

Return to query results.
Submit another query.