DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ASHI and ndufb8

DIOPT Version :9

Sequence 1:NP_001027048.1 Gene:ND-ASHI / 31604 FlyBaseID:FBgn0029888 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_957149.1 Gene:ndufb8 / 393829 ZFINID:ZDB-GENE-040426-1858 Length:188 Species:Danio rerio


Alignment Length:170 Identity:66/170 - (38%)
Similarity:96/170 - (56%) Gaps:12/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAF---VKTVCLAQKLCAANPVVARQAIRSMAGWNKDYKPGPYPQTEKERLAAAKKYYLLPEEY 62
            |:||   :.|..|.:...::...:.|.| |:.:|.:||..|||||:|.:|:.||||||.:.||:|
Zfish     1 MAAFRAGLLTPALTKGKSSSISAIIRGA-RAASGSSKDSLPGPYPKTAEEKAAAAKKYNMRPEDY 64

  Fly    63 KPYADDGLGYGDYPKLGYGLGVEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPP--- 124
            :||.|||.|.||||.|. ......:|.||.||:|:.:||..||:....|:|..:|...:..|   
Zfish    65 QPYPDDGWGSGDYPMLP-SRSQHERDPYYQWDHPDLRRNWGEPMHYHFDMYIRNRVDTSPTPLDW 128

  Fly   125 RYSNAYYFACFLGVMSGCLALYYWLDDKKMYRPVAAKQYP 164
            |....:.|. |||:   .:.::...:....|:||||||||
Zfish   129 RTMRLWLFG-FLGL---TMFMFGMGEVLPSYQPVAAKQYP 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ASHINP_001027048.1 NDUF_B8 25..164 CDD:283478 58/141 (41%)
ndufb8NP_957149.1 NDUF_B8 22..188 CDD:283478 61/149 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581819
Domainoid 1 1.000 107 1.000 Domainoid score I6470
eggNOG 1 0.900 - - E1_KOG4040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3668
Inparanoid 1 1.050 107 1.000 Inparanoid score I4904
OMA 1 1.010 - - QHG47153
OrthoDB 1 1.010 - - D1427659at2759
OrthoFinder 1 1.000 - - FOG0008020
OrthoInspector 1 1.000 - - oto41024
orthoMCL 1 0.900 - - OOG6_105301
Panther 1 1.100 - - LDO PTHR12840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4440
SonicParanoid 1 1.000 - - X6915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.