DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm6 and mcm-7

DIOPT Version :10

Sequence 1:NP_511065.1 Gene:Mcm6 / 31603 FlyBaseID:FBgn0025815 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_504199.1 Gene:mcm-7 / 178831 WormBaseID:WBGene00003159 Length:730 Species:Caenorhabditis elegans


Alignment Length:84 Identity:18/84 - (21%)
Similarity:31/84 - (36%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RVSSQVSPSKYNQHRTSSSNGVQGGS----GGRREYINGSGSGLNGNS---------SNQNHSEY 520
            |:.:::...|....|..|.|.|.|..    |  .:|:|...:.:.|.:         .|..|.:.
 Worm    25 RIVNELKSHKNLWMRCYSKNDVIGPKIIPVG--YDYVNSFRANIWGTTRFMCTLKQRPNYRHYQN 87

  Fly   521 SDAVRQRGPGGSGGRLDYR 539
            ..|.:|.....:|...|:|
 Worm    88 FTAFKQYTAYDNGADWDWR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm6NP_511065.1 MCM_N 22..109 CDD:464206
MCM 113..649 CDD:475121 18/84 (21%)
MCM6_C 702..816 CDD:465688
mcm-7NP_504199.1 MCM_N 14..107 CDD:464206 18/84 (21%)
MCM 162..651 CDD:475121
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.