DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and LUC7

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_010196.1 Gene:LUC7 / 851471 SGDID:S000002245 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:68/317 - (21%)
Similarity:124/317 - (39%) Gaps:104/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQMLDELMGR------NRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHD 64
            |:::::||||      ||..|...   .:...||:.|:.|.|..||:|||..|:..||.|.::|.
Yeast    12 RKLVEQLMGRDFSFRHNRYSHQKR---DLGLHDPKICKSYLVGECPYDLFQGTKQSLGKCPQMHL 73

  Fly    65 EEARHLYE-DARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQE 128
            .:.:..|| :.:..:...::|.|:|...:..:::.:.:|....|.|.....::..:    .:..|
Yeast    74 TKHKIQYEREVKQGKTFPEFEREYLAILSRFVNECNGQISVALQNLKHTAEERMKI----QQVTE 134

  Fly   129 QLANLTARINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTK-- 191
            :|..|..||          |:.|                :|.:.|::..|.....:.|:.|.:  
Yeast   135 ELDVLDVRI----------GLMG----------------QEIDSLIRADEVSMGMLQSVKLQELI 173

  Fly   192 SAEDELQHHPRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDK 256
            |...|:....|:                                     .|::.|::|       
Yeast   174 SKRKEVAKRVRN-------------------------------------ITENVGQSA------- 194

  Fly   257 TSEKTDSKAAGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLR 313
                              :::::|||:|||:|...|..:|:.||.:||.||||.|:|
Yeast   195 ------------------QQKLQVCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 67/315 (21%)
LUC7 3..322 CDD:281222 68/317 (21%)
LUC7NP_010196.1 LUC7 8..261 CDD:227527 68/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.