DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and LUC7L

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_958815.1 Gene:LUC7L / 55692 HGNCID:6723 Length:371 Species:Homo sapiens


Alignment Length:449 Identity:121/449 - (26%)
Similarity:181/449 - (40%) Gaps:140/449 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHL 70
            |.:||:|||..|:  ..|...:|.:.|...|:.:.:..||||:...||.|||.|.:|||...|..
Human     8 RALLDQLMGTARD--GDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD 70

  Fly    71 YEDARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQLANLTA 135
            ||.| ..:|...:|.:.:......:.:.||:.:..|:||   ...|..:.|.:|...|::..|..
Human    71 YEIA-SKERDLFFELDAMDHLESFIAECDRRTELAKKRL---AETQEEISAEVSAKAEKVHELNE 131

  Fly   136 RINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAEDELQHH 200
            .|.|||::||:.|..|:||::|.::...|:::.:|                    |.||:|.:: 
Human   132 EIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKK--------------------KEAEEEYRN- 175

  Fly   201 PRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSEKTDSKA 265
                            .:||            ||.|                             
Human   176 ----------------SMPA------------SSFQ----------------------------- 183

  Fly   266 AGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGY-------SKLRNAVAEINE-- 321
                     :::::|||:|.|:|.:.|..:|:.||..||.|||:       .:||..|||..|  
Human   184 ---------QQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKR 239

  Fly   322 -----ARQKEREQEER--RRREGRV---QRFHSYD-SRREPRSEYRERSRDYVQNRQPSDRRHHH 375
                 .|::|||:|||  ||...|.   :|..|.| .||..||..|||.:   .:|..|..||..
Human   240 NQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRK---LSRSRSRDRHRR 301

  Fly   376 HKSHHSSHHSYSRSGGGGGGVGVGGGGGGGSSRSNRSHHNHNHNHYRHDSRERHCRSRS 434
            |:|...||                       ||.:|.........|:. ||||..|..|
Human   302 HRSRSRSH-----------------------SRGHRRASRDRSAKYKF-SRERASREES 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 77/313 (25%)
LUC7 3..322 CDD:281222 83/329 (25%)
LUC7LNP_958815.1 LUC7 5..242 CDD:397349 83/326 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..371 42/132 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.