DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and luc7l3

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001016304.1 Gene:luc7l3 / 549058 XenbaseID:XB-GENE-5815904 Length:434 Species:Xenopus tropicalis


Alignment Length:472 Identity:154/472 - (32%)
Similarity:218/472 - (46%) Gaps:153/472 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AARQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEAR 68
            :|.|:|||||||:|||.|.|....|:|:....|::|..:|||.:||.|||:|||||.:||||..|
 Frog     3 SAAQLLDELMGRDRNLAPDEKRTNVHWDRESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLR 67

  Fly    69 HLYEDARPSQR--KRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPN-VPAPLSRHQEQL 130
            ..||   .|.|  |..||.:|||:...:|.:|:|:|::|..||.|.|..|.: ...|..:::|::
 Frog    68 KQYE---KSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKI 129

  Fly   131 ANLTARINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAED 195
            ..||.:|:.||.|.||.|..|.|::||.:|.:.|:||||:|                 |.||   
 Frog   130 QVLTDKIDGLLQEIEELGSEGKVEEAQGMMKLVEQLKEERE-----------------LLKS--- 174

  Fly   196 ELQHHPRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSEK 260
                                                                         |:..
 Frog   175 -------------------------------------------------------------TTST 178

  Fly   261 TDSKAAGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLRNAVAEINE---- 321
            .:|.||       .||||:|||:|||||||||||.|::||||||||:||:|:::.|.|:.|    
 Frog   179 IESFAA-------QEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRK 236

  Fly   322 ------------------ARQKEREQEERRRREGRVQRFHSYDSRREPRSEYRERSRDYVQNR-- 366
                              .|:||:|:|:.:.||.|.::     .|||..::.:||:|:..:.:  
 Frog   237 KSSDPDREERSKRERDDKEREKEKEKEKEKEREEREKK-----RRREEEAKEKERNREREKRKRS 296

  Fly   367 --------QPSDR---RHHHHKSHHSSHHSYSRSGGGGGGVGVGGGGGGGSSRSNRSHHNHNHNH 420
                    :.|||   |...||...|.....||                  ||..:...:||...
 Frog   297 RSGSRNSSRTSDRRGSRSRDHKRSRSRDRKRSR------------------SRERQRSQSHNRTE 343

  Fly   421 YRHDSRERHCRSRSRSR 437
            .:|.||.|..| ||:||
 Frog   344 RKHRSRSREKR-RSKSR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 115/311 (37%)
LUC7 3..322 CDD:281222 118/342 (35%)
luc7l3NP_001016304.1 LUC7 4..246 CDD:281222 118/332 (36%)
LUC7 4..238 CDD:227527 118/324 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2296
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 1 1.000 - - FOG0005782
OrthoInspector 1 1.000 - - oto104569
Panther 1 1.100 - - LDO PTHR12375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.