DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and luc7l2

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_012816492.2 Gene:luc7l2 / 548778 XenbaseID:XB-GENE-876728 Length:381 Species:Xenopus tropicalis


Alignment Length:357 Identity:86/357 - (24%)
Similarity:144/357 - (40%) Gaps:116/357 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHL 70
            |.:||:|||.:|:  ......::.:.|...|:.:.:..||||:...||.|||.|.::||...|..
 Frog     8 RALLDQLMGTSRD--GDSTRQRIKFNDERVCKSHLLNCCPHDILSGTRMDLGECLKVHDLALRAD 70

  Fly    71 YEDARPSQRKRQYEDEFLRFCNVMLH------DVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQ 129
            ||.|...|       :|....:.|.|      |.||:.:..|:||...|.:   :.|.::...|:
 Frog    71 YEIASKQQ-------DFFFELDAMDHLQSFIADCDRRTEIAKKRLADTQEE---ISAEVAAKAER 125

  Fly   130 LANLTARINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAE 194
            :..|...|.|||::||:.|..|:|:::|.:|...|:.:..|.:                      
 Frog   126 VHELNEEIGKLLAKAEQLGAEGNVEESQKVMDEVEKTRVRKRE---------------------- 168

  Fly   195 DELQHHPRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSE 259
                           :||.....:||            ||.|                       
 Frog   169 ---------------AEEIYRNSMPA------------SSFQ----------------------- 183

  Fly   260 KTDSKAAGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLRNAVAEI----- 319
                           :::::|||:|.|:|.:.|..:|:.||..||.|||:.::|..:.|:     
 Frog   184 ---------------QQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDELKRLVA 233

  Fly   320 ------NEARQKEREQEERRRREGRVQRFHSY 345
                  |:.|.|.||:.:|..||...:||:.:
 Frog   234 EKQEKRNQDRLKRREERDREEREKLKRRFYCF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 74/312 (24%)
LUC7 3..322 CDD:281222 77/332 (23%)
luc7l2XP_012816492.2 LUC7 5..245 CDD:397349 78/335 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.