DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and LUC7L3

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001317259.1 Gene:LUC7L3 / 51747 HGNCID:24309 Length:489 Species:Homo sapiens


Alignment Length:470 Identity:158/470 - (33%)
Similarity:214/470 - (45%) Gaps:147/470 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDAARQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDE 65
            |:.|| |:|||||||:|||.|.|..:.|.|:....|::|...|||.:||.|||:|||||.:||||
Human     1 MISAA-QLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDE 64

  Fly    66 EARHLYEDARPSQR--KRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPA-PLSRHQ 127
            ..|..||   .|.|  |..||.:|||:...:|.:|:|:|::|..||.|.|..|.:..| |..:::
Human    65 NLRKQYE---KSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNE 126

  Fly   128 EQLANLTARINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKS 192
            |::..||.:|:.||.:.||.|..|.|::||.:|.:.|:||||:|.|                   
Human   127 EKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELL------------------- 172

  Fly   193 AEDELQHHPRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKT 257
                     ||                                                     |
Human   173 ---------RS-----------------------------------------------------T 175

  Fly   258 SEKTDSKAAGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLRNAVAEINE- 321
            :...:|.||       .||||:|||:|||||||||||.|::||||||||:||:|::..|.|:.| 
Human   176 TSTIESFAA-------QEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEK 233

  Fly   322 --------------------------ARQKEREQEERRRREGRVQRFHSYDSRREPRSEYRERSR 360
                                      .|::|||:.||:||....:|.......||.|...|.|||
Human   234 LRKRTEEPDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSR 298

  Fly   361 DYVQNRQPSDR---RHHHHKSHHSSHHSYSRSGGGGGGVGVGGGGGGGSSRSNRSHHNHNHNHYR 422
               .:.:.|||   |...||...|.....||                  ||..|...:|:.:..:
Human   299 ---HSSRTSDRRCSRSRDHKRSRSRERRRSR------------------SRDRRRSRSHDRSERK 342

  Fly   423 HDSRERHCRSRSRSR 437
            |.||.|. |.||:||
Human   343 HRSRSRD-RRRSKSR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 117/314 (37%)
LUC7 3..322 CDD:281222 119/348 (34%)
LUC7L3NP_001317259.1 LUC7 4..246 CDD:397349 119/333 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140821
Domainoid 1 1.000 235 1.000 Domainoid score I2382
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 1 1.000 - - FOG0005782
OrthoInspector 1 1.000 - - oto90775
orthoMCL 1 0.900 - - OOG6_103742
Panther 1 1.100 - - LDO PTHR12375
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 1 1.000 - - X4172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.