DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and Luc7l

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006246068.1 Gene:Luc7l / 360503 RGDID:1307542 Length:371 Species:Rattus norvegicus


Alignment Length:446 Identity:116/446 - (26%)
Similarity:177/446 - (39%) Gaps:134/446 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHL 70
            |.:||:|||..|:  ..|...:|.:.|...|:.:.:..||||:...||.|||.|.:|||...|..
  Rat     8 RALLDQLMGTARD--GDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD 70

  Fly    71 YEDARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQLANLTA 135
            ||.| ..:|...:|.:.:......:.:.||:.:..|:||   ...|..:.|.:|...|::..|..
  Rat    71 YEIA-SKERDLFFELDAMDHLESFIAECDRRTELAKKRL---AETQEEISAEVSAKAEKVHELNE 131

  Fly   136 RINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAEDELQHH 200
            .|.|||::||:.|..|:||::|.::...|:::.:|                    |.||:|.:: 
  Rat   132 EIGKLLAKAEQLGAEGNVDESQKILMEVEKVRSKK--------------------KEAEEEYRN- 175

  Fly   201 PRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSEKTDSKA 265
                            .:||            ||.|                             
  Rat   176 ----------------SMPA------------SSFQ----------------------------- 183

  Fly   266 AGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGY-------SKLRNAVAEINEAR 323
                     :::::|||:|.|:|.:.|..:|:.||..||.|||:       .:||..|||..|.|
  Rat   184 ---------QQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKR 239

  Fly   324 QKE----REQEERRRREGRVQRFHSYDSRR-EPRSEYRERSRDYVQNRQPSDR-----RHHHHKS 378
            .::    ||:.||..|.||.....:.|.|| ..|...|.|||...:.|:...|     |:..|:|
  Rat   240 NQDRLRRREEREREERLGRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKFSRSRSRDRYRRHRS 304

  Fly   379 HHSSHHSYSRSGGGGGGVGVGGGGGGGSSRSNRSHHNHNHNHYRHDSRERHCRSRS 434
            ...||                       ||.:|.........|:. ||||..|..|
  Rat   305 RSRSH-----------------------SRGHRRASRDRSTKYKF-SRERSLREES 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 77/313 (25%)
LUC7 3..322 CDD:281222 82/322 (25%)
Luc7lXP_006246068.1 LUC7 5..241 CDD:281222 84/325 (26%)
LUC7 5..230 CDD:227527 78/314 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.