DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and Luc7l2

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006236376.1 Gene:Luc7l2 / 312251 RGDID:1308651 Length:408 Species:Rattus norvegicus


Alignment Length:432 Identity:112/432 - (25%)
Similarity:172/432 - (39%) Gaps:138/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHLYEDARPSQRKRQYEDEFLRFC 91
            ::.:.|...|:.:.:..||||:...||.|||.|.::||...|..||.|       ..|.:|....
  Rat    43 RIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIA-------SKEQDFFFEL 100

  Fly    92 NVMLH------DVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQLANLTARINKLLSEAEEAGIR 150
            :.|.|      |.||:.:..|:||   ...|..:.|.::...|::..|...|.|||::.|:.|..
  Rat   101 DAMDHLQSFIADCDRRTEVSKKRL---AETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAE 162

  Fly   151 GDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAEDELQHHPRSSPVTNPSEESPT 215
            |:|:::|.:|...|:.:.:|.:..:.|                        |:|           
  Rat   163 GNVEESQKVMDEVEKARAKKREAEEVY------------------------RNS----------- 192

  Fly   216 TPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSEKTDSKAAGWSHDAMPEKQMKV 280
              :||            ||.|                                      :::::|
  Rat   193 --MPA------------SSFQ--------------------------------------QQKLRV 205

  Fly   281 CEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLRNAVAEI-----------NEARQKEREQEERRR 334
            ||:|.|:|.:.|..:|:.||..||.|||:.::|..:.|:           |:.|.|.||:.||..
  Rat   206 CEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREE 270

  Fly   335 REG-RVQRFHSYDSRREPRSEY-RERSRDYVQNRQPSDRRHHHHKSHHSSHHSYSRSGGGGGGVG 397
            ||. |..|.||.:.:|....|: |.|||...:.|    :|....||....|...|||        
  Rat   271 REKLRRSRSHSKNPKRSRSREHRRHRSRSMSRER----KRRTRSKSREKRHRHRSRS-------- 323

  Fly   398 VGGGGGGGSSRS-NRSHHNHNHNHYRHDSRERHCRSRSRSRY 438
                    |||| :|||....|:. |..||||..|..|:.|:
  Rat   324 --------SSRSRSRSHQRSRHSS-RDRSRERSKRRSSKERF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 67/291 (23%)
LUC7 3..322 CDD:281222 70/311 (23%)
Luc7l2XP_006236376.1 LUC7 41..245 CDD:367386 69/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.