DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and usp106

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_588000.1 Gene:usp106 / 2539055 PomBaseID:SPCC16A11.13 Length:264 Species:Schizosaccharomyces pombe


Alignment Length:342 Identity:81/342 - (23%)
Similarity:143/342 - (41%) Gaps:95/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDAARQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDE 65
            |....|:::::|||.|.:...|.  ..|::.|.:.|:.:....||||:|.||:.|||||.:||.:
pombe     1 MAAEQRKIIEQLMGSNLSNFTSR--GLVHFTDRKVCRSFLCGICPHDIFTNTKMDLGPCPKIHSD 63

  Fly    66 EARHLYEDARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQL 130
            :.:..||.|..| ....||.::       |.|::|.:....:|:     |........::.:|: 
pombe    64 KLKSDYERASYS-HDYGYEWDY-------LEDLERHVDDCNKRI-----DIAEARREKTKEEEE- 114

  Fly   131 ANLTARINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSI-SLTKSAE 194
                 ||::|:.:.    |..| ...:.::|..|.|  .|.:||.....|...::.: :..|...
pombe   115 -----RIDELMRDI----IHTD-HSIEVIITEMEAL--AKRKLVNDAVKHFIELNRLKTYRKELY 167

  Fly   195 DELQHHPRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSE 259
            ||:                        .:::|.|      :||:.|                   
pombe   168 DEV------------------------ISMNEIP------SQASTT------------------- 183

  Fly   260 KTDSKAAGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLRNAVAEINEARQ 324
                           .::::||:||.|:|...|..:|:.||..||.||||:.|||...::.  .|
pombe   184 ---------------HQKLQVCDICSAYLSRLDNDRRLADHFSGKMHLGYAMLRNIARDLR--AQ 231

  Fly   325 KEREQEERRRREGRVQR 341
            .|..::.|.:::|..||
pombe   232 LEDREKSRDKKDGEKQR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 72/312 (23%)
LUC7 3..322 CDD:281222 74/319 (23%)
usp106NP_588000.1 LUC7 1..264 CDD:227527 81/342 (24%)
LUC7 3..245 CDD:281222 77/335 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.