DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and luc-7L

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_741025.1 Gene:luc-7L / 174246 WormBaseID:WBGene00015207 Length:313 Species:Caenorhabditis elegans


Alignment Length:457 Identity:104/457 - (22%)
Similarity:167/457 - (36%) Gaps:163/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDAARQMLDELMGRNRNLHPSEAGAKVNWEDPEF-------CQFYNVKFCPHDLFINTR-ADLG 57
            |.|..|.|:.:|||   :.|..      |.|.|..       |:.:.:..||||:..::| .::.
 Worm     1 MTDQMRDMIAQLMG---SQHVD------NKEKPSMPFDHHSVCRAFLLGVCPHDMVPDSRLQNVV 56

  Fly    58 PCARIHDEEARHLYEDARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAP 122
            .|.::|:...:..||.|: .::...|:.:........:|.||.:|.|.:::|      :.:|...
 Worm    57 SCRKVHEPAHKADYERAQ-KEKDHFYDVDAFEIIEHAVHLVDIEIAKVREKL------EDDVKTQ 114

  Fly   123 LSR----HQEQLANLTARINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKA 183
            .|:    ..:|:|.:..:|.|.:.:.|:.|..|.::::..|....|||:|:.:::          
 Worm   115 TSQAADSKAKQVAEIEEKIAKNVDDIEKLGNEGKIEESMKLHKYVEELREKIQEI---------- 169

  Fly   184 ISSISLTKSAEDELQHHPRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEA 248
                                       |:|.|          |...|.|.|..|           
 Worm   170 ---------------------------EDSQT----------EVKTAGPGSNSA----------- 186

  Fly   249 AGAASEDKTSEKTDSKAAGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLR 313
                                        :::|||.|||.|.:.|.:.||.||..||.|:|..:.|
 Worm   187 ----------------------------KLRVCEDCGAQLNITDHESRIADHYNGKMHIGMVETR 223

  Fly   314 NAVAEINEA---RQKEREQEERRRREGRVQRFHSYDSRRE---PRSEYR-ERSRDYVQNRQPSDR 371
            ....::.|.   |:||||::...:|  ..||..|| .||:   .|.||| :|.||    |:..||
 Worm   224 ETYLKMKETIDERRKEREEKLGSQR--GYQRRESY-GRRDRGGDRGEYRGDRDRD----RRNRDR 281

  Fly   372 RHHHHKSHHSSHHSYSRSGGGGGGVGVGGGGGGGSSRSNRSHHNHNHNHYRHDSRERHCRSRSRS 436
                   ..|...||.|...|                         ...|..|:|:|..|.|   
 Worm   282 -------SRSRDRSYRRDDRG-------------------------DRRYDRDNRDRRDRDR--- 311

  Fly   437 RY 438
            ||
 Worm   312 RY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 67/323 (21%)
LUC7 3..322 CDD:281222 67/330 (20%)
luc-7LNP_741025.1 LUC7 1..245 CDD:227527 74/345 (21%)
LUC7 3..246 CDD:281222 73/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.