DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and FMC1-LUC7L2

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001231513.1 Gene:FMC1-LUC7L2 / 100996928 HGNCID:44671 Length:458 Species:Homo sapiens


Alignment Length:432 Identity:112/432 - (25%)
Similarity:172/432 - (39%) Gaps:138/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHLYEDARPSQRKRQYEDEFLRFC 91
            ::.:.|...|:.:.:..||||:...||.|||.|.::||...|..||.|       ..|.:|....
Human    93 RIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIA-------SKEQDFFFEL 150

  Fly    92 NVMLH------DVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQLANLTARINKLLSEAEEAGIR 150
            :.|.|      |.||:.:..|:||   ...|..:.|.::...|::..|...|.|||::.|:.|..
Human   151 DAMDHLQSFIADCDRRTEVAKKRL---AETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAE 212

  Fly   151 GDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAEDELQHHPRSSPVTNPSEESPT 215
            |:|:::|.:|...|:.:.:|.:..:.|                        |:|           
Human   213 GNVEESQKVMDEVEKARAKKREAEEVY------------------------RNS----------- 242

  Fly   216 TPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSEKTDSKAAGWSHDAMPEKQMKV 280
              :||            ||.|                                      :::::|
Human   243 --MPA------------SSFQ--------------------------------------QQKLRV 255

  Fly   281 CEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLRNAVAEI-----------NEARQKEREQEERRR 334
            ||:|.|:|.:.|..:|:.||..||.|||:.::|..:.|:           |:.|.|.||:.||..
Human   256 CEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREE 320

  Fly   335 REG-RVQRFHSYDSRREPRSEY-RERSRDYVQNRQPSDRRHHHHKSHHSSHHSYSRSGGGGGGVG 397
            ||. |..|.||.:.:|....|: |.|||...:.|    :|....||....|...|||        
Human   321 REKLRRSRSHSKNPKRSRSREHRRHRSRSMSRER----KRRTRSKSREKRHRHRSRS-------- 373

  Fly   398 VGGGGGGGSSRS-NRSHHNHNHNHYRHDSRERHCRSRSRSRY 438
                    |||| :|||....|:. |..||||..|..|:.|:
Human   374 --------SSRSRSRSHQRSRHSS-RDRSRERSKRRSSKERF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 67/291 (23%)
LUC7 3..322 CDD:281222 70/311 (23%)
FMC1-LUC7L2NP_001231513.1 Complex1_LYR_2 9..101 CDD:289975 1/7 (14%)
LUC7 89..294 CDD:227527 68/297 (23%)
LUC7 91..307 CDD:281222 69/310 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.