DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3198 and zgc:158803

DIOPT Version :9

Sequence 1:NP_572337.1 Gene:CG3198 / 31602 FlyBaseID:FBgn0029887 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001083016.1 Gene:zgc:158803 / 100038767 ZFINID:ZDB-GENE-070424-15 Length:417 Species:Danio rerio


Alignment Length:443 Identity:119/443 - (26%)
Similarity:179/443 - (40%) Gaps:128/443 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQMLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHL 70
            |.|||:|||..|:  ......::.:.|...|:.:.::.||||:...||.|||.|.:|||...|..
Zfish     8 RAMLDQLMGTGRD--GDTMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECVKIHDLALRAD 70

  Fly    71 YEDARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAPLSRHQEQLANLTA 135
            ||.| ..|::..:|.:........:.|.||:.:..|:||   ...|..:.|.::...|::..|..
Zfish    71 YEIA-SKQQEFFFELDAAEHLQSFIADCDRRTELAKKRL---AETQEEISAEVAAKAERVHELNE 131

  Fly   136 RINKLLSEAEEAGIRGDVDQAQDLMTVCEELKEEKEQLVQQYEAHHKAISSISLTKSAEDELQHH 200
            .|.|||:.||:.|..|:||:||.::...|:.:                    :|.|.|||..:: 
Zfish   132 EIGKLLARAEQLGGEGNVDEAQQVLEKVEKTR--------------------TLKKEAEDIYRN- 175

  Fly   201 PRSSPVTNPSEESPTTPLPAATTLDEAPDAAPSSAQAAVTTTDDAGEAAGAASEDKTSEKTDSKA 265
                            .:||            ||.|                             
Zfish   176 ----------------SMPA------------SSFQ----------------------------- 183

  Fly   266 AGWSHDAMPEKQMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGY-------SKLRNAVAEINE-- 321
                     :::::|||:|.|:|.:.|..:|:.||..||.|:|:       .|||.||.|..|  
Zfish   184 ---------QQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKLRKAVTEKQERM 239

  Fly   322 --ARQKEREQEERRRREGRVQRFHSYDSRREPRSEYRERSRDYVQNRQPSDRRHHHHKSHHSSHH 384
              .|::||::||.|.||..::|     .|...|...|||.|:..:.|   ||.....:|...|..
Zfish   240 RTKRREERDREEERAREWEMER-----ERERERERERERERERERER---DRERDRRRSRSRSGE 296

  Fly   385 SYSRSGGGGGGVGVGGGGGGGSSRSNRSHHNHNHNHYRHDSRERHCRSRSRSR 437
            .|..               ||||.|:|| ..|..:..|...|||..|.:.|.|
Zfish   297 RYRE---------------GGSSSSHRS-RRHREDGERERERERKHRHKDRHR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3198NP_572337.1 LUC7 1..313 CDD:227527 77/313 (25%)
LUC7 3..322 CDD:281222 83/326 (25%)
zgc:158803NP_001083016.1 LUC7 5..242 CDD:281222 83/326 (25%)
LUC7 5..230 CDD:227527 78/314 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.