DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and CTR2

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_012045.3 Gene:CTR2 / 856580 SGDID:S000001218 Length:189 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:65/200 - (32%)
Similarity:86/200 - (43%) Gaps:64/200 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 HAGHAAHGAHNHGGGSGTGMEHMMPMAFHFGYNET-ILFSWWHIETVAGLIGSMIAIFLLALMYE 119
            :||| .|...:.|.|..|   ..|.|.|.:.|..| ::|.||||:|:.|||.|.:|||.||.:||
Yeast    40 NAGH-DHSDMHMGDGDDT---CSMNMLFSWSYKNTCVVFEWWHIKTLPGLILSCLAIFGLAYLYE 100

  Fly   120 GLKYYREYLFWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQP--------- 175
            .|||                                              .|||:.         
Yeast   101 YLKY----------------------------------------------CVHKRQLSQRVLLPN 119

  Fly   176 PSMLSINH---LLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVT 237
            .|:..||.   :..::|:.|||..||:|||:|||||.||.|.||.||..|.:.:|...|..:|.:
Yeast   120 RSLTKINQADKVSNSILYGLQVGFSFMLMLVFMTYNGWLMLAVVCGAIWGNYSWCTSYSPEIDDS 184

  Fly   238 E-HCH 241
            . .||
Yeast   185 SLACH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 53/159 (33%)
CTR2NP_012045.3 Ctr 61..166 CDD:398012 49/150 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I2015
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I1525
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - oto99131
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - LDO PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.