DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and COPT1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_200711.1 Gene:COPT1 / 836020 AraportID:AT5G59030 Length:170 Species:Arabidopsis thaliana


Alignment Length:214 Identity:58/214 - (27%)
Similarity:91/214 - (42%) Gaps:70/214 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MHHDHVGMHHDHSGIP-AATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHM 78
            |.|||  ||    |:| .:::|....:||.:                 :|:.|.|||. ..|:.|
plant     1 MDHDH--MH----GMPRPSSSSSSSPSSMMN-----------------NGSMNEGGGH-HHMKMM 41

  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIG-SMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVT 142
            |.|.|.:|.|..:|||.|. .|.:|:.. .:|.:|.||::.|          |..::.| .|..|
plant    42 MHMTFFWGKNTEVLFSGWP-GTSSGMYALCLIFVFFLAVLTE----------WLAHSSL-LRGST 94

  Fly   143 GPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTY 207
            |...|..|                                .|:||.::.|::.|::|:||..|::
plant    95 GDSANRAA--------------------------------GLIQTAVYTLRIGLAYLVMLAVMSF 127

  Fly   208 NVWLCLMVVLGAAVGYFLF 226
            |..:.|:.:.|.|||:.||
plant   128 NAGVFLVALAGHAVGFMLF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 38/147 (26%)
COPT1NP_200711.1 Ctr 45..146 CDD:367839 36/144 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.