DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and COPT5

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_197565.1 Gene:COPT5 / 832188 AraportID:AT5G20650 Length:146 Species:Arabidopsis thaliana


Alignment Length:149 Identity:38/149 - (25%)
Similarity:67/149 - (44%) Gaps:21/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVT 142
            ||.|.|::|...||||.:|..::....|.::||.|:.:..|:.|:..|          ::::.::
plant     1 MMHMTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLENRR----------IQFKSLS 55

  Fly   143 GPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTY 207
            ..:|.|..||..|..:|...|           .....|.......||..:...:.:||||..|::
plant    56 SSRRAPPPPRSSSGVSAPLIP-----------KSGTRSAAKAASVLLFGVNAAIGYLLMLAAMSF 109

  Fly   208 NVWLCLMVVLGAAVGYFLF 226
            |..:.:.:|:|...||.:|
plant   110 NGGVFIAIVVGLTAGYAVF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 36/146 (25%)
COPT5NP_197565.1 Ctr 4..128 CDD:398012 35/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4266
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2590
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.