DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and COPT4

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_850289.1 Gene:COPT4 / 818369 AraportID:AT2G37925 Length:145 Species:Arabidopsis thaliana


Alignment Length:145 Identity:32/145 - (22%)
Similarity:59/145 - (40%) Gaps:45/145 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYE-GLKYYREYLFWKTYNLLEYRPVTGPQR 146
            |::|||..:|||.|.        ||...::.|||::. .|.:..|:|                .|
plant    34 FYWGYNCQVLFSGWP--------GSDRGMYALALIFVFFLAFLAEWL----------------AR 74

  Fly   147 NPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYNVWL 211
            ..:|..|                   ||....|: ....:|.::.::...|:|::|..:::|..:
plant    75 CSDASSI-------------------KQGADKLA-KVAFRTAMYTVKSGFSYLVILAVVSFNGGV 119

  Fly   212 CLMVVLGAAVGYFLF 226
            .|..:.|.|:|:.:|
plant   120 FLAAIFGHALGFAVF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 31/143 (22%)
COPT4NP_850289.1 Ctr 33..134 CDD:398012 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.