DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and COPT6

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_850091.1 Gene:COPT6 / 817239 AraportID:AT2G26975 Length:145 Species:Arabidopsis thaliana


Alignment Length:202 Identity:43/202 - (21%)
Similarity:75/202 - (37%) Gaps:76/202 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHMMPMAFHFGYNE 89
            ||..:|.::.|.|...:..::|                               ||.|.|.:|.|.
plant     2 DHGNMPPSSPSSMVNHTNSNMI-------------------------------MMHMTFFWGKNT 35

  Fly    90 TILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVTGPQRNPEAPRIP 154
            .||||.|...::...:..:|.:||||::.|.|.:         .::|..|..|...:.       
plant    36 EILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAH---------SSILRGRGSTSRAKG------- 84

  Fly   155 SPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGA 219
                                         |:||.::.|:..|::|:||..|::|..:.::.:.|.
plant    85 -----------------------------LVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGF 120

  Fly   220 AVGYFLF 226
            |||:.||
plant   121 AVGFMLF 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 34/146 (23%)
COPT6NP_850091.1 Ctr 25..127 CDD:282057 34/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.