DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and slc31a2

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_002937270.1 Gene:slc31a2 / 733902 XenbaseID:XB-GENE-5805083 Length:175 Species:Xenopus tropicalis


Alignment Length:168 Identity:57/168 - (33%)
Similarity:84/168 - (50%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLL------- 136
            |.|.|.|..|.|:||.:|.::|:||||.|.:.:.||.::||..|      .||: |||       
 Frog     1 MQMYFVFSENVTLLFDFWTVQTLAGLILSCVVVLLLTVLYEVSK------VWKS-NLLGQALQTF 58

  Fly   137 ----EYRPVTGPQRNPEA-------PRIPSPAAAAPSPVQYVGEVVHKQPPSMLS---INHLLQT 187
                .:.|......:|||       |.:||.:.:.....:....:|.:..||..|   ..|...:
 Frog    59 PIRSTHEPTPSSTPDPEASSSIVCDPLLPSASLSHQHVERLPPVIVERTQPSSNSRWWFLHSFLS 123

  Fly   188 LLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFL 225
            |||:.||.|.::|||..|:||..:.:.||||:.:||||
 Frog   124 LLHMSQVVLGYMLMLCVMSYNAAIFIAVVLGSGLGYFL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 57/168 (34%)
slc31a2XP_002937270.1 Ctr 3..161 CDD:367839 54/164 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.140

Return to query results.
Submit another query.