DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and slc31a2

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001185678.1 Gene:slc31a2 / 563012 ZFINID:ZDB-GENE-030925-25 Length:171 Species:Danio rerio


Alignment Length:169 Identity:49/169 - (28%)
Similarity:80/169 - (47%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWK-TYNLLEYRPVT 142
            |.|.|....|.|:||::|::...||::.|:..:.||.::||.||      .|| |....:..|.|
Zfish     1 MNMYFEGSSNVTLLFNFWNVHGPAGMVLSVFVVLLLTVVYELLK------VWKITVGKQKSSPNT 59

  Fly   143 GPQ-------------------RNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLS--INHLLQ 186
            .|.                   :...:....||:..:.:|.:...........:...  |.|.||
Zfish    60 SPSTAMSFSQNKQSCFATVIKCQEGSSSLANSPSEVSLTPTENTDNAADSSTAAKRRRWILHCLQ 124

  Fly   187 TLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFL 225
            |.:|::||||.::|||..|:||:|:.|.|:.|:.:|||:
Zfish   125 TAIHIVQVTLGYMLMLCVMSYNIWIFLGVITGSVLGYFV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 49/169 (29%)
slc31a2NP_001185678.1 Ctr <116..163 CDD:282057 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.