DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and K12C11.6

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001076607.1 Gene:K12C11.6 / 4926921 WormBaseID:WBGene00045052 Length:132 Species:Caenorhabditis elegans


Alignment Length:165 Identity:41/165 - (24%)
Similarity:69/165 - (41%) Gaps:52/165 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNL 135
            ||....||.   ||....:|:||..|::.....::.....|.:..::.|.:|:.|    ||.   
 Worm     4 SGPPFMHMW---FHTKTQDTVLFKTWNVTDTPTMVWVCCIIVVAGILLELIKFLR----WKI--- 58

  Fly   136 LEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSIN---------HLLQTLLHV 191
                                             |..||....::|.:         |:.||:|.:
 Worm    59 ---------------------------------EKWHKNRDELVSRSYISRLFSPIHIGQTILFM 90

  Fly   192 LQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            :|::.|::|||:|||::|||.:.||:|..:||..|
 Worm    91 VQLSFSYILMLLFMTFSVWLGIAVVVGLGIGYLAF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 36/155 (23%)
K12C11.6NP_001076607.1 Ctr 9..125 CDD:282057 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D564753at33208
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.