DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and K12C11.7

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001076608.1 Gene:K12C11.7 / 4926895 WormBaseID:WBGene00045053 Length:166 Species:Caenorhabditis elegans


Alignment Length:157 Identity:51/157 - (32%)
Similarity:73/157 - (46%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYR 139
            |..||.|.|||...|.|||..|......|.:.|.|::|.:|...|.||:.|:.:   |..:.|..
 Worm     2 MMDMMQMYFHFRIQEPILFRQWKPTDTTGYVFSCISLFFIAFCLELLKFGRQRM---TRTVKEKL 63

  Fly   140 PV----TGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSIN---HLLQTLLHVLQVTLS 197
            .|    :.|:...|.|..|.|:..        |::....|.:|.||:   |...:.|..||..:.
 Worm    64 AVDCCCSTPEGIWEIPEEPEPSPR--------GKLASLAPFTMESISSWRHFASSFLFFLQNFVD 120

  Fly   198 FLLMLIFMTYNVWLCLMVVLGAAVGYF 224
            :.|||:.||||..|...::.|.|:|||
 Worm   121 YSLMLVAMTYNYPLFFSLLAGHAIGYF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 49/153 (32%)
K12C11.7NP_001076608.1 Ctr 9..148 CDD:282057 47/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.