DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and ctr5

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_594269.1 Gene:ctr5 / 2542949 PomBaseID:SPAC1142.05 Length:173 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:44/176 - (25%)
Similarity:69/176 - (39%) Gaps:48/176 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GGSGTGMEH---------MMPMAFH-FGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLK- 122
            |.||.||..         .|.|.:: :.::...|...|||.|.....||:|.||..|:..|||. 
pombe    10 GMSGMGMGSSSNSSAATCRMSMLWNWYIHDSCFLAKSWHINTGNKFAGSIIGIFFFAVAIEGLSL 74

  Fly   123 YYREYLFW-------KTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLS 180
            ..|.:..|       ||        ::||.|                 :.:....||     :..
pombe    75 VQRMFDRWIVAHSNGKT--------LSGPLR-----------------IFFPSSTVH-----VTV 109

  Fly   181 INHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            ...|::..::......:.:||||.|::|.:..|...:||.:|:|||
pombe   110 WQQLIRAAMYSSFYLSATILMLIVMSFNGYAILFGFVGAWIGFFLF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 37/155 (24%)
ctr5NP_594269.1 Ctr 29..155 CDD:282057 37/155 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I3667
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.