DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and ctr4

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_587968.1 Gene:ctr4 / 2538731 PomBaseID:SPCC1393.10 Length:289 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:51/228 - (22%)
Similarity:89/228 - (39%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGME 76
            |.||.    ||:..:|      .:||...:|.:.....|.:..|::..:.         ||..|.
pombe    62 DTSMS----GMNMTNS------TTPMSGMNMTNSTTSMSGMNMSNSTTSM---------SGMNMT 107

  Fly    77 HMMPMAFHFGYNETILFSW-----------WHIETVAGLIGSMIAIFLLALMYEGLKY-YREYLF 129
            :....|.......::.::|           |||.:....:||:..|..:.:..|.::. .||:..
pombe   108 NTTTTAKASSCKLSMYWNWYTIDACFITKHWHITSKHMFVGSIFGIIFMMMALELVRRGQREFDR 172

  Fly   130 WKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSI-NHLLQTLLHVLQ 193
            |                   ..|..|||:   :...:.|..||..|...|.| .|.|::..:::|
pombe   173 W-------------------CVRRFSPAS---NSCCHSGAPVHSGPSMALRIFLHFLRSCFYLVQ 215

  Fly   194 VTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            ..::::.||:.|.||.::.|.:..|...|||||
pombe   216 YIVAYIAMLLAMYYNGYVILFLFCGTFFGYFLF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 35/159 (22%)
ctr4NP_587968.1 Ctr 121..248 CDD:282057 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I3667
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.