DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and Slc31a2

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_079562.1 Gene:Slc31a2 / 20530 MGIID:1333844 Length:143 Species:Mus musculus


Alignment Length:155 Identity:52/155 - (33%)
Similarity:78/155 - (50%) Gaps:28/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVTG 143
            |||.|.|.....:||.:|.:.:..|:..|::.:.|||::|||:|..:..|..||   ||..|.|.
Mouse     1 MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKT---LESLPATN 62

  Fly   144 PQRNPEAPRIPSPAAAAPSP--------VQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLL 200
            .|:....|...|..:.:.|.        :.|.|                 |:|:||:||.:.:.:
Mouse    63 SQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFG-----------------QSLVHVIQVVIGYFV 110

  Fly   201 MLIFMTYNVWLCLMVVLGAAVGYFL 225
            ||..|:||.|:.|.||||:||||:|
Mouse   111 MLAVMSYNTWIFLGVVLGSAVGYYL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 52/155 (34%)
Slc31a2NP_079562.1 Ctr 1..135 CDD:282057 51/153 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.