DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and Slc31a1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_780299.2 Gene:Slc31a1 / 20529 MGIID:1333843 Length:196 Species:Mus musculus


Alignment Length:248 Identity:96/248 - (38%)
Similarity:125/248 - (50%) Gaps:59/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |:|.     |::|...|.|:||:|....|   |..|                   |.......:|
Mouse     1 MNHM-----GMNHMEMHHHMGMNHTDDNI---TMPP-------------------HHHPTTSASH 38

  Fly    66 NHGGGSGTGMEHMMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
            :||||...   .||||.|:|.: |..:|||...|.|...:.|:.:|:||||:.|||||..||.|.
Mouse    39 SHGGGDSM---MMMPMTFYFDFKNVNLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLL 100

  Fly   130 WKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVV---HKQ-PPSMLSINHLLQTL 188
            .|:...:.|.  ||.||.                      |.::   ||. ...|||..|||||:
Mouse   101 RKSQVSIRYNSMPVPGPN----------------------GTILMETHKTVGQQMLSFPHLLQTV 143

  Fly   189 LHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ||::||.:|:.|||||||||.:||:.|..||..|||||.|||:|:||:|||||
Mouse   144 LHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 64/153 (42%)
Slc31a1NP_780299.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..41 6/43 (14%)
Ctr 51..181 CDD:367839 62/151 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6859
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1399
Inparanoid 1 1.050 151 1.000 Inparanoid score I4354
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - oto92318
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - LDO PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.