DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and Y58A7A.1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001256056.1 Gene:Y58A7A.1 / 190381 WormBaseID:WBGene00021975 Length:163 Species:Caenorhabditis elegans


Alignment Length:219 Identity:59/219 - (26%)
Similarity:87/219 - (39%) Gaps:74/219 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGM 75
            :|||.|      ||.|.|....||.....:|                                  
 Worm     1 MDHSQH------HHVHKGTIGNTAVAQTKSS---------------------------------- 25

  Fly    76 EHMM---PMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLE 137
            :|||   .|:||||..|||||.:|..||..|:..:.....|||.:.|.|:::|:|.  |....|.
 Worm    26 DHMMMNHAMSFHFGTEETILFDFWKTETAVGIAVACFITVLLAFLMETLRFFRDYR--KAQTQLH 88

  Fly   138 YRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLML 202
            ..|::...|...:|::                             .|:..||.:.|:|:::.|||
 Worm    89 QPPISPEDRLKRSPQL-----------------------------DLIDPLLQLFQLTIAYFLML 124

  Fly   203 IFMTYNVWLCLMVVLGAAVGYFLF 226
            ||||:|.:||...|:|..|.:.|:
 Worm   125 IFMTFNAYLCFFTVVGEVVCHLLY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 45/149 (30%)
Y58A7A.1NP_001256056.1 Ctr 34..147 CDD:282057 44/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.