DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and F31E8.4

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_495391.1 Gene:F31E8.4 / 174118 WormBaseID:WBGene00017954 Length:162 Species:Caenorhabditis elegans


Alignment Length:171 Identity:62/171 - (36%)
Similarity:86/171 - (50%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYL-FWKTYNLLEYRPVT 142
            |.|..|||..|.||||||...:::|:..||:..|||.::||.:|.:|.:| .|....        
 Worm     3 MDMTLHFGEREKILFSWWKTGSLSGMAVSMLITFLLCILYEAIKSFRYFLAVWNNQK-------- 59

  Fly   143 GPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLS--------INHLLQTLLHVLQVTLSFL 199
            ..||:.|| .|.:|..:....:.  .:.:|..|...||        ...|.|..|:.||..|::.
 Worm    60 RQQRHAEA-SITNPQNSGGDNIS--EDSIHIAPLVQLSGFTKRLFTSYRLAQGALYGLQALLAYT 121

  Fly   200 LMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHC 240
            ||||.||||:.|.|.:|:|.|||||||.....|...:|:.|
 Worm   122 LMLIAMTYNMNLILSIVVGEAVGYFLFTGNPLVEQHLTDCC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 57/155 (37%)
F31E8.4NP_495391.1 Ctr 3..148 CDD:282057 57/155 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I5094
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm14077
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - LDO PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.