DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and SLC31A1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001850.1 Gene:SLC31A1 / 1317 HGNCID:11016 Length:190 Species:Homo sapiens


Alignment Length:248 Identity:99/248 - (39%)
Similarity:128/248 - (51%) Gaps:65/248 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |||:|             |:||            |.||:         .|.:|.||.......:|
Human     1 MDHSH-------------HMGM------------SYMDS---------NSTMQPSHHHPTTSASH 31

  Fly    66 NHGGGSGTGMEHMMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
            :||||..:.|  ||||.|:||: |..:|||...|.|...:.|:.:|:||||:.|||||..||.|.
Human    32 SHGGGDSSMM--MMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLL 94

  Fly   130 WKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVV---HKQ-PPSMLSINHLLQTL 188
            .|:...:.|.  ||.||.                      |.::   ||. ...|||..|||||:
Human    95 RKSQVSIRYNSMPVPGPN----------------------GTILMETHKTVGQQMLSFPHLLQTV 137

  Fly   189 LHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ||::||.:|:.|||||||||.:||:.|..||..|||||.|||:|:||:|||||
Human   138 LHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 65/153 (42%)
SLC31A1NP_001850.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 16/67 (24%)
Ctr 45..175 CDD:398012 63/151 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6604
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1399
Inparanoid 1 1.050 157 1.000 Inparanoid score I4297
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - oto88750
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - LDO PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.