DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3224 and AT2G36930

DIOPT Version :9

Sequence 1:NP_572335.1 Gene:CG3224 / 31600 FlyBaseID:FBgn0029885 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_565854.1 Gene:AT2G36930 / 818267 AraportID:AT2G36930 Length:198 Species:Arabidopsis thaliana


Alignment Length:183 Identity:49/183 - (26%)
Similarity:80/183 - (43%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMVSKRKKMHYGDTHLQRRWRVRNRRRDLDQI--DD----DLQTRSGELINQNVDLDKPGFAQF 59
            ||....||..       :||...:..|||..::  ||    :|:....|:....:|.|.||..||
plant     1 MGRCPTRKVK-------KRRLSHKTARRDKFEVKGDDLVYTELRKPETEIKPLQLDEDLPGMGQF 58

  Fly    60 YCVHCAKYFIDDTAMQAHFRTKVHKRRLKALEIE-PYSIEEAERAAGRGS------------FVK 111
            ||:||.:||.:.:....||:||.||:|:..:..: |:|..:|:.|.|.|.            |.:
plant    59 YCLHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTE 123

  Fly   112 PKKRAMETQPSKEDVVAGKRIRVEVVP---EDTDATDSPSTSKTKRKKVEKME 161
            .:|      |..||:....:....:..   .:....|....:|..:|:|:|:|
plant   124 LRK------PETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKKRVKKIE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3224NP_572335.1 UFD2 <49..119 CDD:227443 27/82 (33%)
AT2G36930NP_565854.1 UFD2 1..118 CDD:227443 38/123 (31%)
C2H2 Zn finger 60..82 CDD:275371 9/21 (43%)
UFD2 <127..186 CDD:227443 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5112
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445352at2759
OrthoFinder 1 1.000 - - FOG0003984
OrthoInspector 1 1.000 - - oto3435
orthoMCL 1 0.900 - - OOG6_103042
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.