DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3224 and znf593

DIOPT Version :9

Sequence 1:NP_572335.1 Gene:CG3224 / 31600 FlyBaseID:FBgn0029885 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_021322858.1 Gene:znf593 / 559352 ZFINID:ZDB-GENE-040426-1789 Length:155 Species:Danio rerio


Alignment Length:112 Identity:51/112 - (45%)
Similarity:76/112 - (67%) Gaps:1/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HLQRRWRVRNRRRDLDQIDDD-LQTRSGELINQNVDLDKPGFAQFYCVHCAKYFIDDTAMQAHFR 79
            ::.:.|:.:.|.:|||||..| :.|.:.:|:.|:||.|..|..|.||:|||:||:|...::.||:
Zfish    43 NIAKTWKTKRRTKDLDQIHADMIPTNAAKLLKQDVDYDVTGCGQHYCLHCARYFVDLKTLKEHFK 107

  Fly    80 TKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQPSKEDV 126
            :|.||:|||.|..|||:..|||||||.||::.||...:.||..:||:
Zfish   108 SKPHKKRLKQLREEPYTQAEAERAAGMGSYIPPKTLEVHTQQVEEDM 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3224NP_572335.1 UFD2 <49..119 CDD:227443 36/69 (52%)
znf593XP_021322858.1 zf-C2H2_jaz 27..134 CDD:331206 42/90 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578403
Domainoid 1 1.000 46 1.000 Domainoid score I12128
eggNOG 1 0.900 - - E1_COG5112
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41070
Inparanoid 1 1.050 113 1.000 Inparanoid score I4831
OMA 1 1.010 - - QHG54265
OrthoDB 1 1.010 - - D1445352at2759
OrthoFinder 1 1.000 - - FOG0003984
OrthoInspector 1 1.000 - - oto39157
orthoMCL 1 0.900 - - OOG6_103042
Panther 1 1.100 - - LDO PTHR46095
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R155
SonicParanoid 1 1.000 - - X2745
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.