DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3224 and znf593

DIOPT Version :9

Sequence 1:NP_572335.1 Gene:CG3224 / 31600 FlyBaseID:FBgn0029885 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001016550.1 Gene:znf593 / 549304 XenbaseID:XB-GENE-1217394 Length:128 Species:Xenopus tropicalis


Alignment Length:123 Identity:57/123 - (46%)
Similarity:83/123 - (67%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKRKKMHYGD--THLQRRWRVRNRRRDLDQIDDDLQTRSGE-LINQNVDLDKPGFAQFYCVHCAK 66
            ||:...|..|  .::.:.|:.:.|.:|||||..|::..:.: |:||.:|...||.||.||:||::
 Frog     4 SKQVGNHKSDKKKNISKLWKTKRRVKDLDQIHHDMKPENAKLLLNQEIDYQLPGNAQHYCLHCSR 68

  Fly    67 YFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQPSKE 124
            ||:|...::.||:|||||||||.|..|||:.||||||||.||::.||...::||.:.|
 Frog    69 YFVDLKTLKEHFKTKVHKRRLKQLREEPYTQEEAERAAGMGSYIPPKLINVQTQDTME 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3224NP_572335.1 UFD2 <49..119 CDD:227443 39/69 (57%)
znf593NP_001016550.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/16 (25%)
zf-C2H2_jaz 11..108 CDD:391512 46/96 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11850
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41070
Inparanoid 1 1.050 118 1.000 Inparanoid score I4640
OMA 1 1.010 - - QHG54265
OrthoDB 1 1.010 - - D1445352at2759
OrthoFinder 1 1.000 - - FOG0003984
OrthoInspector 1 1.000 - - oto104603
Panther 1 1.100 - - LDO PTHR46095
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R155
SonicParanoid 1 1.000 - - X2745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.