DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3224 and ZNF593

DIOPT Version :9

Sequence 1:NP_572335.1 Gene:CG3224 / 31600 FlyBaseID:FBgn0029885 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_056955.2 Gene:ZNF593 / 51042 HGNCID:30943 Length:134 Species:Homo sapiens


Alignment Length:142 Identity:61/142 - (42%)
Similarity:81/142 - (57%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQ----TRSGELINQNVDLDKPGFAQFYCVHCA 65
            |:|...|...: |.|:.:.:.||.|||:|..:|:    .|.....|...|.|.||.....|:.||
Human     4 SRRTGAHRAHS-LARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACA 67

  Fly    66 KYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQPSKEDVVAGK 130
            :||||.|.::.|||:|.||:|||.|.:||||.||||||||.||:|.|::.|:.|:.|.|      
Human    68 RYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTE------ 126

  Fly   131 RIRVEVVPE-DT 141
                  ||| ||
Human   127 ------VPEMDT 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3224NP_572335.1 UFD2 <49..119 CDD:227443 39/69 (57%)
ZNF593NP_056955.2 UFD2 1..108 CDD:227443 47/104 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..134 32/63 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145093
Domainoid 1 1.000 51 1.000 Domainoid score I11650
eggNOG 1 0.900 - - E1_COG5112
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41070
Inparanoid 1 1.050 101 1.000 Inparanoid score I4997
Isobase 1 0.950 - 0 Normalized mean entropy S1615
OMA 1 1.010 - - QHG54265
OrthoDB 1 1.010 - - D1445352at2759
OrthoFinder 1 1.000 - - FOG0003984
OrthoInspector 1 1.000 - - oto90811
orthoMCL 1 0.900 - - OOG6_103042
Panther 1 1.100 - - LDO PTHR46095
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R155
SonicParanoid 1 1.000 - - X2745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.